PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G206200.1
Common NamePHAVU_007G206200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 402aa    MW: 45119.4 Da    PI: 7.096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G206200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l+d+++++G g+W+++++  g+ R++k+c++rw +yl
  Phvul.007G206200.1 14 KGLWSPEEDEKLLDYITRHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding43.19.7e-1467110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E+  ++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Phvul.007G206200.1  67 RGAFSQQEENMIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                         89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.901965IPR017930Myb domain
SuperFamilySSF466892.96E-2912108IPR009057Homeodomain-like
SMARTSM007175.9E-131363IPR001005SANT/Myb domain
PfamPF002494.0E-161461IPR001005SANT/Myb domain
CDDcd001671.15E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2565116IPR009057Homeodomain-like
SMARTSM007172.1E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129420.01566116IPR017930Myb domain
PfamPF002491.1E-1267111IPR001005SANT/Myb domain
CDDcd001677.91E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLDYIT RHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENMIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRS  120
IDPNTHKPLS EVENGKDIPP STDKSNQKAS LGSHEVSLVD QPAKALLPSS ERYPLEVSTS  180
STQKLFLDRF GATCHGNSCK PSDVVGPYFS FQHLNYGTTN MDLSANSNDS LCFIPPCTSS  240
DLNNSTITSS MLHSIFPTHV KIQSNDNPSI SSDAVQNWES NNTNKSNGSM QFQSSTNFLD  300
NTWGMVESTK VNINKDAQVP LQAEQEDLKW SEYLNTPFIL GNTPQNQIQT SQSIYSEVKP  360
DTEFITDESC TSWHHQPPAF QLSDINSNVL QRFSVTFGQT L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145057.10.0hypothetical protein PHAVU_007G206200g
TrEMBLV7BKF70.0V7BKF7_PHAVU; Uncharacterized protein
STRINGGLYMA20G22230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-110myb domain protein 61